DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and gish

DIOPT Version :9

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster


Alignment Length:673 Identity:130/673 - (19%)
Similarity:206/673 - (30%) Gaps:278/673 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKSATNMDCANTNLESAGKSSSTNYNRNRFYNERFVPMASGTMPSVSGTNHHSRHQQLLLQQAPK 92
            |.||.|:..|.|.| :.|||||     |..|:         |..|||.|..       :|...|.
  Fly    19 GPSAGNVANATTAL-AGGKSSS-----NNMYS---------TRQSVSTTTG-------VLMVGPN 61

  Fly    93 CTADLNEKLVKINRQNANKELSTIQAKDMQSVDKNEEALKELQESIPEINKIFDVHCRIGSGTFS 157
                                                                |.|..:||.|.|.
  Fly    62 ----------------------------------------------------FRVGKKIGCGNFG 74

  Fly   158 TVLLG--------------TLQRERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENV 208
            .:.||              .::.:...:..:.|.:.:...:..|.|:.|.|    :|.:|     
  Fly    75 ELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPR----IYHLG----- 130

  Fly   209 IGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSN 273
               .|..|||..|..::.....|.|:...|..:...:....:.||..:.:||..::|:|||||.|
  Fly   131 ---TCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPEN 192

  Fly   274 ILYNRRTGK----FLLCDFGLAQRIADDGSVVQSSDLSSREVFSILRDLENGRSV------TLTD 328
            .|..|.:.|    ..:.|||||:...                     ||:..|.:      :|| 
  Fly   193 FLIGRTSTKREKIIHIIDFGLAKEYI---------------------DLDTNRHIPYREHKSLT- 235

  Fly   329 GNSAQAEAEDYMARRRMR-----ALGG------GGSVE----RAVTGPPSIQKLREQ-------- 370
            |.:.......:|.|.:.|     |||.      .||:.    :|.|.....||:.:.        
  Fly   236 GTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV 300

  Fly   371 -AGGHLTKKDVANQRADTMRLLNRLR--------------------------------------- 395
             ..||      ..:.|..:|.:.||.                                       
  Fly   301 LCDGH------PEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTP 359

  Fly   396 ----------LVSPNADPNNYVVSTNTSKKEMHASRAGTPGYRPPEVLLRYPKQSTAVDVWAAGV 450
                      ::|||.|.:|....||        ::.|...:  |:|    ||..          
  Fly   360 VGSLQTGHEVIISPNKDRHNVTAKTN--------AKGGVAAW--PDV----PKPG---------- 400

  Fly   451 IMLSLLSGLHPFFKAPHDCGALAEIINLFGDM-PVRKTAFLLDRLILLAQKVNTLDLRRVCMRFR 514
               :.|..|.|..:  |  |::..:.:..|:: |...||...:..|....:|..:|..:.|..|:
  Fly   401 ---ATLGNLTPADR--H--GSVQVVSSTNGELNPDDPTAGHSNTPITQQPEVEVVDETKCCCFFK 458

  Fly   515 HADFFLAPEIQRKYQRP---DGTTEMCRSCEQPTFNCLCSNSGHNLERYDGLDIFPAVAYDLLSR 576
            ..        ::|..|.   ||.  .| |.|:.....|.:.| |:..|...|:            
  Fly   459 RK--------KKKSTRQKXLDGV--QC-SPEREAVTLLRATS-HSNSRDSVLN------------ 499

  Fly   577 LLEVNPQ----KRITAEEALKHP 595
                ||.    ::.|::..|::|
  Fly   500 ----NPSQDYIQQATSQHTLRYP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 109/558 (20%)
S_TKc 145..597 CDD:214567 109/556 (20%)
PKc_like <238..>363 CDD:304357 36/149 (24%)
PKc_like <364..>462 CDD:304357 22/155 (14%)
PKc_like <427..597 CDD:304357 35/177 (20%)
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 66/384 (17%)
S_TKc 62..335 CDD:214567 66/312 (21%)
CK1gamma_C 354..428 CDD:289378 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.