DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and dco

DIOPT Version :9

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster


Alignment Length:174 Identity:42/174 - (24%)
Similarity:67/174 - (38%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECM-------------YR 201
            :||||:|..:.|||                     ..|..|.:..:|||:             |:
  Fly    14 KIGSGSFGDIYLGT---------------------TINTGEEVAIKLECIRTKHPQLHIESKFYK 57

  Fly   202 I--GGVENVIGINCCI------RYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRH 258
            .  ||    |||...|      .||..|..::.....|.|:...|..:...:......::..:.:
  Fly    58 TMQGG----IGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDY 118

  Fly   259 VHKFNVIHRDVKPSNIL--YNRRTGKFLLCDFGLAQRIADDGSV 300
            :|..:.||||:||.|.|  ..::.....:.|||||::..|..|:
  Fly   119 IHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 42/174 (24%)
S_TKc 145..597 CDD:214567 42/174 (24%)
PKc_like <238..>363 CDD:304357 17/65 (26%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 42/174 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.