DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and dco

DIOPT Version :10

Sequence 1:NP_609876.2 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_524602.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster


Alignment Length:174 Identity:42/174 - (24%)
Similarity:67/174 - (38%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPTNHPERILRELECM-------------YR 201
            :||||:|..:.|||                     ..|..|.:..:|||:             |:
  Fly    14 KIGSGSFGDIYLGT---------------------TINTGEEVAIKLECIRTKHPQLHIESKFYK 57

  Fly   202 I--GGVENVIGINCCI------RYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRH 258
            .  ||    |||...|      .||..|..::.....|.|:...|..:...:......::..:.:
  Fly    58 TMQGG----IGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDY 118

  Fly   259 VHKFNVIHRDVKPSNIL--YNRRTGKFLLCDFGLAQRIADDGSV 300
            :|..:.||||:||.|.|  ..::.....:.|||||::..|..|:
  Fly   119 IHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_609876.2 STKc_Cdc7 143..597 CDD:270921 42/174 (24%)
Protein Kinases, catalytic domain <238..>363 CDD:473864 17/65 (26%)
Protein Kinases, catalytic domain <427..597 CDD:473864
dcoNP_524602.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 42/174 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.