DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and CG8878

DIOPT Version :9

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster


Alignment Length:358 Identity:65/358 - (18%)
Similarity:120/358 - (33%) Gaps:109/358 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SAGKSSSTNYNRNRFYNERFVPMASGTMPSVSGTN-------HHSRHQQLLLQQAPKCTADLNEK 100
            |.|.||:..:.    ::|.....:..:..|.:||.       |..:.:.|||..|...:...|..
  Fly    34 SGGSSSANGFE----FHENDDEESCSSAGSAAGTEADPPTLLHTPQARSLLLTGASIASDHNNSS 94

  Fly   101 LVKINRQNANKELSTIQAKDMQSVDKNEEALKELQESIPEINKIFDVHCRIGSGTFSTVLLGTLQ 165
            :::..|.......|.:....::.|                ::|.:.:...||.|.|..:.|.: .
  Fly    95 VMESPRPVYTLRPSVVNGTILRDV----------------LSKAWRLGRPIGKGNFGEIFLAS-D 142

  Fly   166 RERGLVETQRRRFAIKHHNPTNHPERILRELECMYRIGGVENVIGINCCIRYND------NVAFI 224
            .......::..::.:|....:|.|  :..|:.|:           ||.. |.||      :.|.:
  Fly   143 DTVCPASSETAKYVVKIEPHSNGP--LFVEIHCL-----------INTS-RNNDLSDAAEDAASL 193

  Fly   225 MPYMTH------------------DRFHDI-YRSLNFPEIRDYLRNLL---------IALRHVHK 261
            ....||                  ..|.|: ||.|..|.....|.:|:         :.:..||.
  Fly   194 PAPQTHVLSRGPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIKNSRVQQKSLLVLAVHI 258

  Fly   262 FNVI---------HRDVKPSNILYNRRTGKFLLCDFGLAQRIADDGSVVQSSDLSSREVFSILRD 317
            .||:         |.|:|..|::.::       |.: |.:::...|:..:              |
  Fly   259 INVLENLHDKGYCHNDIKAQNLMVSK-------CKY-LRRQVVPKGNGYE--------------D 301

  Fly   318 LENGRSVTLTDGNSAQAEA--EDYMARRRMRAL 348
            ....:..|...|||::.|.  :||..:....||
  Fly   302 HYEEKQQTTDSGNSSEQETNDDDYFLKSEKFAL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 48/251 (19%)
S_TKc 145..597 CDD:214567 47/249 (19%)
PKc_like <238..>363 CDD:304357 26/131 (20%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 36/211 (17%)
SPS1 123..>284 CDD:223589 34/175 (19%)
SPS1 <491..756 CDD:223589
PKc_like <517..652 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.