DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and CG9962

DIOPT Version :9

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster


Alignment Length:189 Identity:39/189 - (20%)
Similarity:72/189 - (38%) Gaps:59/189 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ESIPEINKIFDVHCRIGSGTFSTVL----LGTLQRERGL---VETQRRRFAIKHHNPTNHPERIL 193
            |::..||.|..:. ::|||:|..:.    :|:     ||   ::.:|:.....|.:..:....:|
  Fly     7 ETMLRINSIMVIR-KLGSGSFGDIYEAKHMGS-----GLHVALKVERKNAGQSHLSIESTVYNLL 65

  Fly   194 RELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDRFHDIY-----------------RSLN 241
            |            :.:||....::..|           |.||:.                 |..:
  Fly    66 R------------HGMGIPMTYQFFSN-----------RRHDVLVMELLGPSLETLFTMCNRRFS 107

  Fly   242 FPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYNRRTG----KFLLCDFGLAQRIAD 296
            ...:......::..|.::|..:.:|||:||.|.|..  .|    :..|.||||::|..|
  Fly   108 MKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG--VGLTRHRLHLIDFGLSKRYWD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 36/182 (20%)
S_TKc 145..597 CDD:214567 35/180 (19%)
PKc_like <238..>363 CDD:304357 18/63 (29%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 35/180 (19%)
STKc_CK1 17..279 CDD:270918 35/179 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.