DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5790 and CkIalpha

DIOPT Version :9

Sequence 1:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:138/359 - (38%) Gaps:94/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EALKELQESIPEI--NKIFDVHCRIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNP-TNHPE 190
            :.::.|:||.|||  ...:.|..:||||:|..:.|| :..:.|      ...|||..:. ..||:
  Fly     2 DKMRILKESRPEIIVGGKYRVIRKIGSGSFGDIYLG-MSIQSG------EEVAIKMESAHARHPQ 59

  Fly   191 RILRELECMYRI--GGV-----------ENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNF 242
             :|.|.: :|||  |||           :|         :|..|..::.....|.|:...|....
  Fly    60 -LLYEAK-LYRILSGGVGFPRIRHHGKEKN---------FNTLVMDLLGPSLEDLFNFCTRHFTI 113

  Fly   243 PEIRDYLRNLLIALRHVHKFNVIHRDVKPSNIL--YNRRTGKFLLCDFGLAQRIADDGS---VVQ 302
            ..:...:..::..|.::|....||||:||.|.|  ..|...|..|.|||||::..|..:   :|.
  Fly   114 KTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVY 178

  Fly   303 SSD--LSSREVFSILR-----------DLEN--------GRSVTLTDGNSAQAEAEDY--MARRR 344
            ..|  |:....::.:.           |:|:        .|.|....|..|..:.:.|  ::.::
  Fly   179 REDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKK 243

  Fly   345 MRALGGGGSVERAVTGPPS--------IQKLREQAGGHLTKKDVANQRADTMRLLNRLRLVSPNA 401
            |..     .:|....|.|:        .:.||.:            ::.|.|.|....|::....
  Fly   244 MST-----PIEVLCKGSPAEFSMYLNYCRSLRFE------------EQPDYMYLRQLFRILFRTL 291

  Fly   402 DPN-NYVVSTNTSKKEMHASRAGTPGYRPPEVLL 434
            :.. :|:......|::.|   .|.|.   |.:||
  Fly   292 NHQYDYIYDWTMLKQKTH---QGQPN---PAILL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 75/343 (22%)
S_TKc 145..597 CDD:214567 75/341 (22%)
PKc_like <238..>363 CDD:304357 33/152 (22%)
PKc_like <364..>462 CDD:304357 14/72 (19%)
PKc_like <427..597 CDD:304357 3/8 (38%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 66/299 (22%)
Pkinase_Tyr 23..284 CDD:285015 65/295 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.