DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and PTP1

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:82/344 - (23%)
Similarity:142/344 - (41%) Gaps:108/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DLRRKFPVLYKLEFQTAAKVESNTCRH------ALKKNNLEKNQNPKCIPYDYNRVVLEKVGGLQ 151
            ||..||..:...|.....:..:.|...      :::..|..:|:....:||:.|||.|:.:.|  
Yeast    14 DLLGKFKFIQNQEDGRLREATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKTLSG-- 76

  Fly   152 DSDYVNASYV-----DSLLKPNAYIVTQGPVEETVQAYWRMVWQ----ENISAIVMLTKTFDFAK 207
             :||:|||||     ...::|..||.||||..:|...:|:|.:.    :|| .|||:|...::.:
Yeast    77 -NDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNI-VIVMVTPLVEYNR 139

  Fly   208 VMCHQYWP-----PNMEVHEQY-------------GDIFINIVREEQLANFHIRT---------- 244
            ..|:||||     ..:.:..::             .|:.|..|...::.:::..|          
Yeast   140 EKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPL 204

  Fly   245 -----------FRLYK-MNEKQEVTDERLILQFHYTEWYSHSCPFSNALLEFRRRVRLVVGNIIK 297
                       |.|:| ||:.:||..   |::.         |..|::|                
Yeast   205 VGPVKTVHHFYFDLWKDMNKPEEVVP---IMEL---------CAHSHSL---------------- 241

  Fly   298 DEDDMRG-PILVHCSDGGGRSGVYMSID----------------ANLELAEEEECFNVFGYL-KK 344
               :.|| ||:||||.|.||:|.::::|                .:.:.|.||...::...: .:
Yeast   242 ---NSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQ 303

  Fly   345 LRQSRKGLVENVEQYKFIY 363
            ||..|..:|:..:|:.|||
Yeast   304 LRSQRMKMVQTKDQFLFIY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 76/306 (25%)
Y_phosphatase 428..671 CDD:395053
PTP1NP_010051.1 COG5599 1..335 CDD:227886 82/344 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.