DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and PTP1

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001031266.1 Gene:PTP1 / 843516 AraportID:AT1G71860 Length:340 Species:Arabidopsis thaliana


Alignment Length:292 Identity:85/292 - (29%)
Similarity:137/292 - (46%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ALKKNNLEKNQNPKCIPYDYNRVVLEKVGGLQDSDYVNASYV-----DSLLKPNAYIVTQGPVEE 179
            |:...|:|||:....:|:|.||:||..........|||||.:     :|:   :.:|.||||:..
plant    82 AMNSVNVEKNRYSDVVPFDKNRIVLNPCKDSSAKGYVNASLIKTSESESI---SQFIATQGPLPH 143

  Fly   180 TVQAYWRMVWQENISAIVMLTKTFDFAK-VMCHQYWPPNMEVHEQYGDIFINIVREEQLANFHIR 243
            |::.:|.||.|::...|||||:..|..: |.|..|: .:.:...::|:|        .|....|:
plant   144 TMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYF-QDEDGPREFGNI--------SLTTKWIK 199

  Fly   244 T------FRLYKMNEKQEVTDERLILQFHYTEWYSHSCPFSN-ALLEFRRRVRLVVGNIIKDEDD 301
            |      .|..::|.|:.......:|...|.||..|..|... |:.|..:|:..|..::      
plant   200 TTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVPPSL------ 258

  Fly   302 MRGPILVHCSDGGGRSGVYMSIDANLE--LAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYD 364
              |||:||||.|.||:|.|.:|...::  ||.:....::...:...|:.|.|:|:.::||.|.|:
plant   259 --GPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQYFFCYN 321

  Fly   365 TLEEHIICGKTWFPVSELSDRLKAKARRNSGT 396
            .:            |.||.|   ..|..|:||
plant   322 AI------------VDELED---LTAGTNAGT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 76/257 (30%)
Y_phosphatase 428..671 CDD:395053
PTP1NP_001031266.1 PTPc_plant_PTP1 117..321 CDD:350496 65/223 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.