DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and PTPRC

DIOPT Version :10

Sequence 1:NP_609872.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_002829.3 Gene:PTPRC / 5788 HGNCID:9666 Length:1306 Species:Homo sapiens


Alignment Length:41 Identity:9/41 - (21%)
Similarity:18/41 - (43%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 KPAIAHRDLKSKNI-LVKSNLTCCIGDLGLAVRHIVATDTV 222
            ||.:.||..:.|.: ..:::.....||:......::..|.|
Human   286 KPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_609872.1 Y_phosphatase 125..368 CDD:459674 9/41 (22%)
Y_phosphatase 428..671 CDD:459674
PTPRCNP_002829.3 PTP_N 7..32 CDD:403599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..163
PHA03255 81..>231 CDD:165513
CD45 237..295 CDD:432641 4/8 (50%)
fn3 393..462 CDD:394996
FN3 485..565 CDD:238020
R-PTPc-C-1 707..907 CDD:350405
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 993..1014
R-PTP-C-2 1017..1223 CDD:350406
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1261..1306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.