DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and PTP-ER

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:467 Identity:83/467 - (17%)
Similarity:130/467 - (27%) Gaps:254/467 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KNQNPKCIPYDYNRVVLE-----------------KVGGLQDSDYVNASYV---DSLLKPNAYIV 172
            ||:....:|.:.:||:||                 .|...:|..|:||:|:   |.:.|  .|:.
  Fly   918 KNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSK--CYVA 980

  Fly   173 TQGPVEETVQAYWRMVW---------------------------QENISAIVMLTKTFDFAKVMC 210
            ||||:..|:..:|.|::                           |:....|||||...:..:..|
  Fly   981 TQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKC 1045

  Fly   211 HQYWPPNMEVHEQY--------------------------------------------------- 224
            ..|:|  :|::|.:                                                   
  Fly  1046 AVYFP--IELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVE 1108

  Fly   225 -------GDIF--------------INIVREE----------------QLANFHIRTFRLYKMNE 252
                   ||:.              :.|||..                |.|::|::....|    
  Fly  1109 SVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCY---- 1169

  Fly   253 KQEVTDERLILQFHYTEWYSHSCPFS-NALLEFRRRVRLVVGNIIKDE------DDMRG------ 304
                       .:.|.:|..|..|.. |.||:    ..|.|.|:.|.|      ||.|.      
  Fly  1170 -----------HYWYPDWPDHHSPRDINTLLD----TCLHVLNLGKCESEFDIYDDTRSERNAHL 1219

  Fly   305 -----------------PI-LVHCSDGGGRSGVYMSI-------------------DANLELAEE 332
                             |: ::|||.|.||:|.:.:|                   ..:|..:..
  Fly  1220 AAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSST 1284

  Fly   333 EECFN----------------------------------------------VFGYLKKLRQSRKG 351
            ||..|                                              |.|.:..||..|.|
  Fly  1285 EEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGG 1349

  Fly   352 LVENVEQYKFIY 363
            :|:|.|||:.|:
  Fly  1350 MVQNSEQYELIH 1361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 83/467 (18%)
Y_phosphatase 428..671 CDD:395053
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 83/467 (18%)
PTPc 917..1364 CDD:238006 83/467 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.