DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and IA-2

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster


Alignment Length:422 Identity:115/422 - (27%)
Similarity:180/422 - (42%) Gaps:96/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ATGGGSS--GAGGGKTGKHRSRSSARYDDVEKQQRKSRAIVSIPNTIKLSMLNSGLLSFERIKLE 66
            |.|||:|  ||.||  |.:....|.|...:.|:                   |.|.....|....
  Fly   884 AGGGGNSTGGAAGG--GSNEPAPSGRITSLSKE-------------------NEGRPPSSRSSTS 927

  Fly    67 ARDENNSLSK-TIPNGPIDIR----HFLKLCDLRRKFPVLYKLEFQTAAKVESNTCRHALKKNNL 126
            :..|..:|:. .|..|.:.:.    |......|:|::..|               ||:..:.:..
  Fly   928 SWSEEPALTNMDISTGHMVLSYMEDHLRNKGRLQREWEAL---------------CRYEAEPSAR 977

  Fly   127 EKNQNPKC---------IPYDYNRVVLEKVGGLQDSDYVNASYV-DSLLKPNAYIVTQGPVEETV 181
            |....|:|         :|||::||||..:...:..||||||.: |...:..||:..|||:..|:
  Fly   978 EAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTL 1042

  Fly   182 QAYWRMVWQENISAIVMLTKTFDFAKVMCHQYWP-PNMEVHEQYGDIFINIVREE-QLANFHIRT 244
            ..:|:|:|::....||.|.:..:..:|.|.:||| ...||:..|.   :::|.|. ...::.:|:
  Fly  1043 AHFWQMIWEQGAVVIVALCRLQENGEVACARYWPEEGAEVYHIYE---VHLVSEHIWCDDYLVRS 1104

  Fly   245 FRLYKMNEKQEVTDERLILQFHYTEWYSHSCPF-SNALLEFRRRVRLVVGNIIKDEDDMRG---- 304
            |.|..:    ..::.|.:.|||:..|.....|. :.|||:|||:|          ....||    
  Fly  1105 FYLKNL----RTSETRTVTQFHFLSWPHMGVPAQAKALLDFRRKV----------NKSYRGRRSC 1155

  Fly   305 PILVHCSDGGGRSGVYMSIDANLEL----AEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDT 365
            ||:||.|.|.||:|||:.:|..||.    |.|   .::...|:.||..|.|:|...:|::|:...
  Fly  1156 PIVVHGSAGAGRTGVYILLDLVLERMNKGARE---IDIAATLEHLRDQRAGVVATRQQFEFVLMA 1217

  Fly   366 LEEHIICGKTWFPVSELSDRLKAKARRNSGTK 397
            :.|            |:...|||.....||.|
  Fly  1218 VAE------------EVHAILKALPANTSGEK 1237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 81/263 (31%)
Y_phosphatase 428..671 CDD:395053
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 86/294 (29%)
PTPc 995..1220 CDD:238006 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.