DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and Ptpn18

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_038939136.1 Gene:Ptpn18 / 301333 RGDID:1311586 Length:459 Species:Rattus norvegicus


Alignment Length:358 Identity:91/358 - (25%)
Similarity:155/358 - (43%) Gaps:61/358 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EARDENNSLSKTIPNGPIDIRHFLKLCDLRRKFPVLYKLEFQTAAKVESNTCRHALKKNNLEKNQ 130
            ||||..        .|.|..|.|   .|::.: .|.:|.|...:.|..|       ::.|.:||:
  Rat    16 EARDHR--------EGAILAREF---SDIKAR-SVAWKTEGVCSTKAGS-------QQGNSKKNR 61

  Fly   131 NPKCIPYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQENISA 195
            ....:|||..||:|..:......||:||:::.......|||.||||:..|:..:||:||:..:..
  Rat    62 YKDVVPYDETRVILSLLQEEGHGDYINANFIRGTDGSQAYIATQGPLPHTLLDFWRLVWEFGVKV 126

  Fly   196 IVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFINIVREEQL-ANFHIRTFRLYKMNEKQEVTDE 259
            |:|..:..:..:..|.:||....| ..|.|...|.:.:|..| |:..:||.::......:...:.
  Rat   127 ILMACQETENGRRKCERYWAQERE-PLQAGPFCITLTKETALTADITLRTLQVTFQKVPKGQKES 190

  Fly   260 RLILQFHYTEWYSHSCPFSNALLEFRRRVRLVVGNIIKDEDDMR-------GPILVHCSDGGGRS 317
            |.:.|..|..|..|..|.|:             .:|:...::.|       ||:.||||.|.||:
  Rat   191 RPVHQLQYMSWPDHGVPSSS-------------DHILTMVEEARCLQGLGPGPLCVHCSAGCGRT 242

  Fly   318 GVYMSIDANLELAEEEEC---FNVFGYLKKLRQSRKGLVENVEQYKFIYDTLEEHIICGKTWFPV 379
            ||..::|...:|...:..   |::|..:.::|:.|...|:..|||:|:|.|:.:           
  Rat   243 GVLCAVDYVRQLLLTQTIPPNFSLFEVVLEMRKQRPAAVQTEEQYRFLYHTVAQ----------- 296

  Fly   380 SELSDRLKAKARRNSGTKMNEYQAEYDQICKQT 412
                  |.::..:|:.......:.....|||.:
  Rat   297 ------LFSRTLQNNSPLYQNLKENRAPICKDS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 72/253 (28%)
Y_phosphatase 428..671 CDD:395053
Ptpn18XP_038939136.1 PTP_DSP_cys 27..298 CDD:421693 80/312 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.