DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and pyp2

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_594899.1 Gene:pyp2 / 2542200 PomBaseID:SPAC19D5.01 Length:711 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:88/314 - (28%)
Similarity:143/314 - (45%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SKTIPNGPIDIRHFLKLCDLRRKFPVLYKLEFQTAAKV---ESNTCRHALKKNN--LEKNQNPKC 134
            :|.:...|.::...|....:..||..|.::|...:...   :|:.|..|..::.  ..||:....
pombe   403 AKKVSPPPCEVLADLNTASIFYKFKRLEEMEMTRSLAFNDSKSDWCCLASSRSTSISRKNRYTDI 467

  Fly   135 IPYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQEN--ISAIV 197
            :|||..||.|....|.  |||:|||::|  :....||..|.|...|:..:|.|||..:  ...||
pombe   468 VPYDKTRVRLAVPKGC--SDYINASHID--VGNKKYIACQAPKPGTLLDFWEMVWHNSGTNGVIV 528

  Fly   198 MLTKTFDFAKVMCHQYWPPNMEVHE--QYGDIFINIVREEQLANFHIRT--FRLYKMNEKQEVTD 258
            |||..::.....|.||||.|.: |.  ..|.:.|::.:.|...:..:.|  |||.|.|     ..
pombe   529 MLTNLYEAGSEKCSQYWPDNKD-HALCLEGGLRISVQKYETFEDLKVNTHLFRLDKPN-----GP 587

  Fly   259 ERLILQFHYTEWYSHSCPFSNALLEFRRRVRLVVGNIIKDEDDMRGPILVHCSDGGGRSGVYMSI 323
            .:.|..|....|:..:.|...::....|.:         |:....||:.||||.|.||:|.::::
pombe   588 PKYIHHFWVHTWFDKTHPDIESITGIIRCI---------DKVPNDGPMFVHCSAGVGRTGTFIAV 643

  Fly   324 DANLEL----------AEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTLE 367
            |..|::          .|:.:.| :|..:..||..|..:|:|.||:||:||.::
pombe   644 DQILQVPKNILPKTTNLEDSKDF-IFNCVNSLRSQRMKMVQNFEQFKFLYDVVD 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 78/261 (30%)
Y_phosphatase 428..671 CDD:395053
pyp2NP_594899.1 DSP_MapKP 4..129 CDD:238723
COG5599 405..709 CDD:227886 87/312 (28%)
PTPc 461..697 CDD:238006 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.