DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and Ptpn2

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001120649.1 Gene:Ptpn2 / 19255 MGIID:97806 Length:406 Species:Mus musculus


Alignment Length:300 Identity:100/300 - (33%)
Similarity:151/300 - (50%) Gaps:31/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSKTIPNGPIDIRHFLKLCDLRRKFPVLYKLEFQTAAKVESNTCRHALKK--NNLEKNQNPKCIP 136
            :|.||.      |.|.:| |.:.::..|| ||.:.    ||:...|.:.|  .|..:|:.....|
Mouse     1 MSATIE------REFEEL-DAQCRWQPLY-LEIRN----ESHDYPHRVAKFPENRNRNRYRDVSP 53

  Fly   137 YDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQENISAIVMLTK 201
            ||::||.|:..    ::||:|||.||......:||:||||:..|...:|.||||:...|:|||.:
Mouse    54 YDHSRVKLQST----ENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNR 114

  Fly   202 TFDFAKVMCHQYWPPNME--VHEQYGDIFINIVREEQLANFHIRTFRLYKMNEKQEVTDERLILQ 264
            |.:...|.|.||||.:..  |.::.| ..:.::.|:..:.:.:...:|..:|    ..:.|.|..
Mouse   115 TVEKESVKCAQYWPTDDREMVFKETG-FSVKLLSEDVKSYYTVHLLQLENIN----TGETRTISH 174

  Fly   265 FHYTEWYSHSCPFSNA-LLEFRRRVRLVVGNIIKDEDDMRGPILVHCSDGGGRSGVYMSIDANLE 328
            ||||.|.....|.|.| .|.|..:|| ..|.:..|    .||.::|||.|.||||.:..:|..|.
Mouse   175 FHYTTWPDFGVPESPASFLNFLFKVR-ESGCLTPD----HGPAVIHCSAGIGRSGTFSLVDTCLV 234

  Fly   329 LAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTLEE 368
            |.|:.|..||...|..:|:.|.||::..:|.:|.|..:.|
Mouse   235 LMEKGEDVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 84/245 (34%)
Y_phosphatase 428..671 CDD:395053
Ptpn2NP_001120649.1 PTPc 5..274 CDD:214550 97/294 (33%)
PTPc 45..274 CDD:238006 83/242 (34%)
Substrate binding. /evidence=ECO:0000250 216..222 3/5 (60%)
Endoplasmic reticulum location. /evidence=ECO:0000250 341..406
Mediates interaction with STX17. /evidence=ECO:0000250 371..406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.