DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and Y39A3A.4

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001370800.1 Gene:Y39A3A.4 / 189720 WormBaseID:WBGene00021435 Length:265 Species:Caenorhabditis elegans


Alignment Length:292 Identity:69/292 - (23%)
Similarity:112/292 - (38%) Gaps:84/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KLEARDENNSLSKTIPNGPIDIRH--FLKLCD----LRRKFPV--LYKLEFQTAAKVESNTCRHA 120
            |.|.:.|||   |.:.....:..|  :||..:    ...|..:  |.|...:..||.:.:....|
 Worm    10 KNEKKGENN---KDVTGSETEEDHLQYLKALENFIFSTEKLGIDGLVKQYRKLDAKQDPSLTYDA 71

  Fly   121 LKKNNLEKNQNPKCIPYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYW 185
            ..| .:.||:....:..|.:||.| |:...:..||::|:||.:....:.:|.:|||::.|:..:|
 Worm    72 YTK-YMHKNRYCDVVCLDNSRVKL-KIDKSRHGDYIHANYVKTNYLRSTFICSQGPLQHTIIDFW 134

  Fly   186 RMVWQENISAIVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFI--------------------- 229
            ||::||...:|::|.|.   .:....:|| |::.|.|.||.|.:                     
 Worm   135 RMIFQERAESILLLCKV---GREGRPRYW-PSLGVTETYGCIRVTNFSESSEEFEICNLAVTFVP 195

  Fly   230 -NIVREEQLANFHIRTFRLYKM---------NEKQEVTDERLILQFHYTEWYSHSCPFSNALLEF 284
             |:..:||.||.......|.|.         :||.....:||:.|..:                 
 Worm   196 DNVPVDEQPANLEGLRVSLIKWPNWPDCGVPDEKCHTVPQRLLAQVRH----------------- 243

  Fly   285 RRRVRLVVGNIIKDEDDMRGPILVHCSDGGGR 316
                               ||.:||||.|..|
 Worm   244 -------------------GPCVVHCSAGKDR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 53/223 (24%)
Y_phosphatase 428..671 CDD:395053
Y39A3A.4NP_001370800.1 PTPc 51..>256 CDD:214550 58/246 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.