DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and C33H5.16

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_501293.3 Gene:C33H5.16 / 183190 WormBaseID:WBGene00016382 Length:341 Species:Caenorhabditis elegans


Alignment Length:360 Identity:80/360 - (22%)
Similarity:148/360 - (41%) Gaps:80/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RKSRAIVSIPNTIKLSMLNSGLLSFERIKLEARDENNSLSKTIPNGPIDIRHFLKLCDLRRKFPV 100
            :|.|.:.::.:..|......| .:.||.|::.:.....:..|:..|||.:|:             
 Worm     3 QKRRRLPNLKSKEKAEKSQKG-TNDERQKMQKKQIVQFVQTTLEKGPIGLRN------------- 53

  Fly   101 LYKLEFQTAAKVESNTCRHALKK-NNLEKNQNPKCIPYDYNRVVLEKVGGLQDS----------- 153
                ||            :|:|: |:.:|.|:.| ...|:::...:.||.|.::           
 Worm    54 ----EF------------NAMKRFNDFDKMQSFK-KAQDHHKNRYKDVGCLDNNRVKLAHPPWPH 101

  Fly   154 DYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQENISAIVMLTKTFDFAKVMCHQYW---- 214
            ||::|::|.:......:|..|.|::.|...:|.|..||.:.||.||....:.....|.:|:    
 Worm   102 DYIHANFVSTPANAKRFICAQAPLDNTCADFWYMCLQERVEAIFMLCNLMEKGAKKCSEYYATKE 166

  Fly   215 PPNMEVHEQYGDIFINIVREEQLANFHIRTFRLYKMNEKQEVTDERLILQ-----------FHYT 268
            .|.:..||:  |..|.:..|..      .|.:..|.. |..|.:..||::           :|:.
 Worm   167 KPELVFHEK--DQKITVKYEAS------GTVKFVKPT-KAVVKETVLIIEGPGGQVLKTTHYHWI 222

  Fly   269 EWYSHSCPFSN-ALLEFRRRVRLVVGNIIKDEDDMRGPILVHCSDGGGRSGVYMSIDANLE-LAE 331
            :|.....|.:: :::|...:.|           .::|||.||||.|.||:|..:.|:...| |..
 Worm   223 DWPDRGVPPADLSIIELLIKAR-----------PLKGPIAVHCSAGIGRTGSVVMIEYMCEQLLN 276

  Fly   332 EEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTL 366
            ..:.......|:|:|:.|...::...||.|::..:
 Worm   277 GNQIEETDKILQKIREQRNNSIQTDHQYLFVHQVM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 63/270 (23%)
Y_phosphatase 428..671 CDD:395053
C33H5.16NP_501293.3 Y_phosphatase 76..313 CDD:278528 59/256 (23%)
PTPc 77..313 CDD:238006 59/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.