DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and F55H12.5

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_492395.2 Gene:F55H12.5 / 172700 WormBaseID:WBGene00010136 Length:287 Species:Caenorhabditis elegans


Alignment Length:296 Identity:61/296 - (20%)
Similarity:120/296 - (40%) Gaps:77/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 EFQTAAKVESNTCRHALKKNNLEKNQNPKCIPYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNA 169
            ||.....:||.|..:..|... :||.:.....||..||::..|      ||.:||:||. ||||.
 Worm    58 EFYKETYLESPTFFNYFKSPK-DKNFSENVWLYDATRVIVPGV------DYYHASWVDG-LKPNQ 114

  Fly   170 YIVTQGPVE-ETVQAYWRMVWQENISAIVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFIN--I 231
            ||:.|.|.: ...:.:::::.......:::.....:|:..:..::     |......| |::  :
 Worm   115 YILAQAPRDASAAKDFFKLLEHVKAEGLIVAEGADEFSSAITAKF-----EKGTGKND-FVSTAV 173

  Fly   232 VREEQLANFHIRTFRLYKMNEKQEVTDERLILQFHYTEWYSHSCPFS----NALLEFRRRVRLVV 292
            ::|..|   |::..:..:..|                       |.|    |.:||   :.|..:
 Worm   174 IKENGL---HLKAIKFCRWAE-----------------------PLSAIEINDMLE---KSRKYL 209

  Fly   293 GNIIKDEDDMRGPILVHCSDGGGRSGVYMSIDANLELAEEEECFNVFGYLKKLRQSRKGLVENVE 357
            |..:|      ||:::.|.||..:||:...||...:              :.::..:....:.::
 Worm   210 GCPLK------GPLVIVCKDGAAKSGLVAFIDTEAD--------------RLMKHGKAKHTDTIK 254

  Fly   358 QYKFI----YDTLEEHIICGKTWFPVSELSDRLKAK 389
            |.:|:    :||.:.:.:...:   :.||.:|.|.|
 Worm   255 QIRFMRSNTFDTFDSYDLGINS---LIELCNRYKKK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 50/253 (20%)
Y_phosphatase 428..671 CDD:395053
F55H12.5NP_492395.2 PTPc 74..270 CDD:214550 51/258 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.