DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp36E and si:ch1073-391i24.1

DIOPT Version :9

Sequence 1:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_021322118.1 Gene:si:ch1073-391i24.1 / 101886250 ZFINID:ZDB-GENE-110408-69 Length:315 Species:Danio rerio


Alignment Length:352 Identity:98/352 - (27%)
Similarity:159/352 - (45%) Gaps:66/352 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 LELAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTLEEHIICGKTWFPVSELSDRLKAKAR 391
            |::||.|...:::..:::||..|..:|:..|||.||:|.:.|..:||.|..|.::|........|
Zfish     2 LDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTTIPANQLRSVYYDMNR 66

  Fly   392 RNSGTKMNEYQAEYDQICKQTPRFTIGDCAGGHRADNREKNRDVLCVPPDNFRPYLTSFQGNAFT 456
            .:..|..:..:.|:..:...||...:.||:......|.||||.:..:|||...|:|.:..|.: :
Zfish    67 LDPQTNSSPIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDVLPPDRCLPFLITIDGES-S 130

  Fly   457 DYINSVFVDGYTKPREYIVTEWPMKHTLGEFWSLVYDQECSAVVVLCQ-PPSQSQQYPSFWPNKS 520
            :|||:..:|.|.:|..:|||:.|:.:|:.:||.||.|..|:::|:|.. .|:|.|....:     
Zfish   131 NYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSIVMLNDVDPAQMQPQDGY----- 190

  Fly   521 KMEKYGPVFSVHYVMSKSYTNIKQWEFKINKKIVSLTEMMAGVKAPTRTVQLFQLTCWPMGHKVP 585
                                                           |.||.||...|||....|
Zfish   191 -----------------------------------------------RMVQQFQFLGWPMYRDTP 208

  Fly   586 SSTNSLVYLMNMVEIWRNKVD--YGPVCVVSPDGRSRAGVYCAANACIEQVIQHGEVDVFQAVKT 648
            .|..|.:.|::.|:.|:.:.|  .|...|...:|..|:|.:||.:...|.:.....||||.||||
Zfish   209 VSKRSFLKLIHQVDKWQEEYDGGEGRTVVHCLNGGGRSGTFCAISIVSEMLRHQRSVDVFHAVKT 273

  Fly   649 VRRHRPQLVENMTEYKYCYDLVLHYVL 675
            :|.::|.:|          ||::|..|
Zfish   274 LRNNKPNMV----------DLLVHTAL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 14/40 (35%)
Y_phosphatase 428..671 CDD:395053 69/245 (28%)
si:ch1073-391i24.1XP_021322118.1 Y_phosphatase <1..43 CDD:332578 14/40 (35%)
PTPc 76..292 CDD:214550 76/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48012
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000829
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.