DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42750 and PBP1

DIOPT Version :10

Sequence 1:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_200260.1 Gene:PBP1 / 835537 AraportID:AT5G54490 Length:127 Species:Arabidopsis thaliana


Alignment Length:49 Identity:17/49 - (34%)
Similarity:21/49 - (42%) Gaps:14/49 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1004 YPTLFAELLGGGWTIDELTKLAGGNFLRVMQQVEKLRDDKKAAGVKPFE 1052
            :||: |..|||...|:|:.|           ..|.|.|..|  ||..||
plant    23 FPTM-AGKLGGEGLIEEICK-----------GFELLMDKDK--GVITFE 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:395996 9/30 (30%)
PBP1NP_200260.1 EF-hand_8 50..104 CDD:404678 5/10 (50%)

Return to query results.
Submit another query.