DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42750 and cetn3

DIOPT Version :9

Sequence 1:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:35 Identity:10/35 - (28%)
Similarity:19/35 - (54%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1019 DELTKLAGGNFLRVMQQV-EKLRDDKKAAGVKPFE 1052
            ||..|::..|..||.::: |.:.|:...|.:..|:
Zfish   113 DETGKISLRNLRRVARELGEDMSDEDLRAMIDEFD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:279569 6/15 (40%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 10/35 (29%)
EFh 29..91 CDD:238008
EFh 102..164 CDD:238008 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.