powered by:
Protein Alignment CG42750 and cetn3
DIOPT Version :9
Sequence 1: | NP_724101.4 |
Gene: | CG42750 / 35090 |
FlyBaseID: | FBgn0261804 |
Length: | 1068 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001018335.1 |
Gene: | cetn3 / 552931 |
ZFINID: | ZDB-GENE-050522-152 |
Length: | 167 |
Species: | Danio rerio |
Alignment Length: | 35 |
Identity: | 10/35 - (28%) |
Similarity: | 19/35 - (54%) |
Gaps: | 1/35 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1019 DELTKLAGGNFLRVMQQV-EKLRDDKKAAGVKPFE 1052
||..|::..|..||.::: |.:.|:...|.:..|:
Zfish 113 DETGKISLRNLRRVARELGEDMSDEDLRAMIDEFD 147
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0028 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.