DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42750 and Dpep3

DIOPT Version :9

Sequence 1:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_001008384.1 Gene:Dpep3 / 364994 RGDID:1305484 Length:488 Species:Rattus norvegicus


Alignment Length:417 Identity:183/417 - (43%)
Similarity:239/417 - (57%) Gaps:41/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 HWLAVSSILLIIGAASVAVPLALRVAASAP------------------------FEERLR-VAVQ 700
            |.|::..:||||.:..|.........:|||                        .:.||| .|:.
  Rat    19 HRLSLLGVLLIIPSLWVTCNQTTPSLSSAPTSPGASSAMTTPGIPNDTTTSGVTSDPRLREQALA 83

  Fly   701 LLDQVPLIDGHNDLPWNIRKFLHNKLNDFNFDEDLRNVMPWGRSHWSHTDLTRLKKGRISAQFWA 765
            |:...||:|||||||..:|:...|||.|.|.....|          ..|.|.||:.|.:.||||:
  Rat    84 LMRDFPLVDGHNDLPLLLRELFQNKLQDVNLHNFTR----------GQTSLDRLRDGLVGAQFWS 138

  Fly   766 AYVPCEAQHRDAVQLTLEQIDVIKRLTDRYSPQLTTCTSAQDIIDAHKNQQLCSLTGVEGGHSLG 830
            ||:||:.|.||||::.|||||:|:|:...| |:|...|||..:   :..|:|..|.|:||||||.
  Rat   139 AYIPCQTQDRDAVRVALEQIDLIRRMCSAY-PELELVTSADGL---NSTQKLACLIGLEGGHSLD 199

  Fly   831 GSLAVLRTLYAIGVRYMTLTSTCHTPWADSSYADAPTFNMKHGGLTIFGKTIIREMNRLGMMVDL 895
            .||||||:.|.:||||:|||.||.||||:|:......|.....|||.||:.::.||||:|||:||
  Rat   200 TSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRIGMMIDL 264

  Fly   896 SHVSKGTMRDALEVSEAPVIFSHSSAYELCNTSRNVQDDILQALAKNGGLVMVNFYSKFLSCSDN 960
            ||.|...::..||.|.||||||||:|..:|:...||.|||||.|.||||:|||......|.||..
  Rat   265 SHASDTLVKQTLEASRAPVIFSHSAARSVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCSLL 329

  Fly   961 STVHDAVAHINHIKRVAGIDHVGLGAGYDGINYTPKGLEDVSSYPTLFAELLGGGWTIDELTKLA 1025
            :.|.....|.:||:.|.|.:.:|:|..|||....|:||||||:||.|..|||..||...||..:.
  Rat   330 ANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLLEELLRRGWGEQELQGVL 394

  Fly  1026 GGNFLRVMQQVEKLRDDKKAAGVKPFE 1052
            .||.|||.:|||::|:  |:.|..|.|
  Rat   395 RGNLLRVFRQVEQVRE--KSLGQSPVE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:279569 161/333 (48%)
Dpep3NP_001008384.1 Podoplanin 26..>76 CDD:283467 8/49 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..74 3/32 (9%)
Peptidase_M19 83..404 CDD:279569 161/334 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 330 1.000 Domainoid score I1118
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X677
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.