DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42750 and Cetn2

DIOPT Version :10

Sequence 1:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_062278.2 Gene:Cetn2 / 26370 MGIID:1347085 Length:172 Species:Mus musculus


Alignment Length:43 Identity:14/43 - (32%)
Similarity:19/43 - (44%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 IDELTKLAGG-----NFLRVMQQVEKLRDDKK--AAGVKPFED 1053
            |.|:.|...|     :||.||.|....:|.|:  ....|.|:|
Mouse    73 ISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:395996 8/21 (38%)
Cetn2NP_062278.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Required for self-assembly. /evidence=ECO:0000250 2..25
PTZ00183 16..172 CDD:185503 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.