powered by:
Protein Alignment CG42750 and CETN3
DIOPT Version :9
Sequence 1: | NP_724101.4 |
Gene: | CG42750 / 35090 |
FlyBaseID: | FBgn0261804 |
Length: | 1068 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001284694.1 |
Gene: | CETN3 / 1070 |
HGNCID: | 1868 |
Length: | 191 |
Species: | Homo sapiens |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 16/31 - (51%) |
Gaps: | 6/31 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1039 LRD-DKKAAGVKPFEDHPNFRTD-----DPY 1063
|:| |::|.|...|||.....|| ||:
Human 70 LKDYDREATGKITFEDFNEVVTDWILERDPH 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42750 | NP_724101.4 |
Peptidase_M19 |
701..1035 |
CDD:279569 |
|
CETN3 | NP_001284694.1 |
PTZ00183 |
15..190 |
CDD:185503 |
12/31 (39%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0028 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.