DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42750 and CETN2

DIOPT Version :10

Sequence 1:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_004335.1 Gene:CETN2 / 1069 HGNCID:1867 Length:172 Species:Homo sapiens


Alignment Length:33 Identity:12/33 - (36%)
Similarity:17/33 - (51%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1023 KLAGGNFLRVMQQVEKLRDDKK--AAGVKPFED 1053
            |:..|:||.||.|....:|.|:  ....|.|:|
Human    83 KMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:395996 6/11 (55%)
CETN2NP_004335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Required for self-assembly 2..25
PTZ00183 16..172 CDD:185503 12/33 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.