DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD4 and AT1G78280

DIOPT Version :9

Sequence 1:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_177951.6 Gene:AT1G78280 / 844163 AraportID:AT1G78280 Length:943 Species:Arabidopsis thaliana


Alignment Length:310 Identity:75/310 - (24%)
Similarity:128/310 - (41%) Gaps:70/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IERCSGLDYNDFFWRYMHKNIPVIIANVSNDWECQN-WTVGQSSPESRDLNSNPSASSINFDYLK 93
            :||...:..::|...|..|. ||:::.:::.|...| ||:                     |.|.
plant   127 VERRRNISLDEFSKEYDAKK-PVLLSGLADSWPASNTWTI---------------------DQLS 169

  Fly    94 TKISDGPVPVANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVNSNVAPASGDNLY 158
            .|..:.|..::.      .|..|:.:.|.||:|..::..:.                    |.||
plant   170 EKYGEVPFRISQ------RSPNKISMKFKDYIAYMKTQRDE--------------------DPLY 208

  Fly   159 LKDWHLAAQMPG-YNFYKVPKYFASDWLNEQLIQQGKDDYRFVYMGPKNSWTSYHADVFGSFSWS 222
            :.|.......|. ...|.||..|..||. |.|.::.:..||::.:||:.|..|:|.|...:.:|:
plant   209 VFDDKFGEAAPELLKDYSVPHLFQEDWF-EILDKESRPPYRWLIVGPERSGASWHVDPALTSAWN 272

  Fly   223 TNIVGLKKWLIMPPGE-----ELKLNDRLGNLPFSIDEKMLDEHNVRYYTI----------NQRA 272
            |.:.|.|:|.:.|||:     .:.:|:..|::  |||.....:..:.||.:          ....
plant   273 TLLCGRKRWALYPPGKVPLGVTVHVNEDDGDV--SIDTPSSLQWWLDYYPLLADEDKPIECTLLP 335

  Fly   273 NEAVFVPSGWFHQVWNLTDTISVNHNWFNGCNISMVWQNLKNNL--KAVC 320
            .|.::|||||:|.:.||..|::|..|:.|..|...|..::....  |.||
plant   336 GETIYVPSGWWHCILNLEPTVAVTQNFVNKENFGFVCLDMAPGYHHKGVC 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 16/48 (33%)
JmjC 199..299 CDD:202224 32/114 (28%)
AT1G78280NP_177951.6 F-box-like 17..61 CDD:403981
cupin_RmlC-like 137..362 CDD:424065 66/275 (24%)
APH <669..877 CDD:396281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D609279at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.