DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD4 and Jmjd6

DIOPT Version :9

Sequence 1:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006247868.1 Gene:Jmjd6 / 360665 RGDID:1305395 Length:420 Species:Rattus norvegicus


Alignment Length:400 Identity:93/400 - (23%)
Similarity:142/400 - (35%) Gaps:97/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPEEIERCSGLDYN--DFFWRYMHKNIPVIIANVSNDWECQ-NWTVGQ----------SSPESRD 77
            :|:.:||...|..:  :|..||.....||::.|....|..| .||:.:          ...|..|
  Rat    42 VPDNVERADALQLSVKEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDND 106

  Fly    78 LNSNPSASSINFDYLKTKISDGPVPVANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTS 142
            ..|.........:|:::...|.|:.:  .:||| ..|.|......|                   
  Rat   107 GYSVKMKMKYYIEYMESTRDDSPLYI--FDSSY-GEHPKRRKLLED------------------- 149

  Fly   143 AEVNSNVAPASGDNLYLKDWHLAAQMPGYNFYKVPKYFASDWLNEQLIQQGKDDYRFVYMGPKNS 207
                                           |||||:|..| |.:...::.:..||:..|||..|
  Rat   150 -------------------------------YKVPKFFTDD-LFQYAGEKRRPPYRWFVMGPPRS 182

  Fly   208 WTSYHADVFGSFSWSTNIVGLKKWLIMP---PGEELKLNDRLGNLPFSIDEKMLDEHNVRY---- 265
            .|..|.|..|:.:|:..:.|.|:|.:.|   |.|.:|:....|.   :..::.:...||.|    
  Rat   183 GTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREEGG---NQQDEAITWFNVIYPRTQ 244

  Fly   266 ----------YTINQRANEAVFVPSGWFHQVWNLTDTISVNHNWFNGCNISMVWQNLKNNLKAVC 320
                      ..|.|:..|.||||.||:|.|.||..||::..|:.:..|..:||.      |.:.
  Rat   245 LPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWH------KTIQ 303

  Fly   321 NEISDCQQMDNFEAHCQTMLR---ASFGINYLDFIELLEFIAARRLAEGT-VATKFLLFDSYTMN 381
            :....|:.......||...|.   ...||...:..||.....|..|.|.| :|:......|.:.:
  Rat   304 HGQRQCKPPPATPCHCVPTLTWRDQLSGILKQEHPELAVLADAVDLQESTGIASDSSSDSSSSSS 368

  Fly   382 DYHVQYDLEC 391
            ......|.||
  Rat   369 SSSSDSDSEC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 18/48 (38%)
JmjC 199..299 CDD:202224 35/116 (30%)
Jmjd6XP_006247868.1 JmjC 174..288 CDD:396791 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.