DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD4 and Jmjd8

DIOPT Version :9

Sequence 1:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006246060.1 Gene:Jmjd8 / 360498 RGDID:1307381 Length:317 Species:Rattus norvegicus


Alignment Length:307 Identity:60/307 - (19%)
Similarity:113/307 - (36%) Gaps:85/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TDPQLPEE----IERCSGLDYNDFFWRYMHKNIPVIIANVSNDWECQNWTVGQSSPESRDLNSNP 82
            |:..:.||    :||.:.|.|::|...|.... |||:..:::            :.:.|.|.|. 
  Rat    60 TEAAVMEEERCTVERRAHLTYSEFMQHYAFLK-PVILQGLTD------------NSKFRALCSR- 110

  Fly    83 SASSINFDYLKTKISDGPVPVANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVNS 147
                   :.|.....|..|.::..|:   .|:.|::|.|.:|:.:.....:.:|        :.:
  Rat   111 -------ENLLASFGDNVVRLSTANT---YSYQKVDLPFQEYVEQLLHPQDPES--------LGN 157

  Fly   148 NVAPASGDNLYLKDWHLAAQMPGYNFYKVPKY------------------FASDWLNEQLIQQGK 194
            :.....|||.: .:|     .|.:..|:.|.:                  |.:| |.|..|.   
  Rat   158 DTLYFFGDNNF-TEW-----APLFQHYRPPPFRLLGTTPAYSFGIAGRCSFQTD-LGEARIY--- 212

  Fly   195 DDYRFVYMGPKNSWTSYHADVFGS-----FSW-----STNIVGLKKWLIMPPGEELKLNDRLGNL 249
                ||:.       .:..|..|:     |.|     |..|.|.|:|.:.||.:..:.:.....|
  Rat   213 ----FVHQ-------LFTTDPTGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTTL 266

  Fly   250 PFSIDEKMLDEHNVRYYTINQRANEAVFVPSGWFHQVWNLTDTISVN 296
            .:.::.......:.|......:|.||::.|..|:|...||..::.::
  Rat   267 AWLLEIYPSLAPSARPLECTIQAGEALYFPDRWWHATLNLDTSVFIS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 12/71 (17%)
JmjC 199..299 CDD:202224 23/108 (21%)
Jmjd8XP_006246060.1 cupin_like <241..301 CDD:304367 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.