DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD4 and JMJD8

DIOPT Version :9

Sequence 1:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001005920.3 Gene:JMJD8 / 339123 HGNCID:14148 Length:264 Species:Homo sapiens


Alignment Length:277 Identity:53/277 - (19%)
Similarity:98/277 - (35%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IERCSGLDYNDFFWRYMHKNIPVIIANVSNDWECQNWTVGQSSPESRDLNSNPSASSINFDYLKT 94
            :||.:.|.|.:|..:|.... |||:..:::            :...|.|.|.        |.|..
Human    45 VERRADLTYAEFVQQYAFVR-PVILQGLTD------------NSRFRALCSR--------DRLLA 88

  Fly    95 KISDGPVPVANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVNSNVAPASGDNLYL 159
            ...|..|.::..|:   .|:.|::|.|.:|:.:.....:..|        :.::.....|||.: 
Human    89 SFGDRVVRLSTANT---YSYHKVDLPFQEYVEQLLHPQDPTS--------LGNDTLYFFGDNNF- 141

  Fly   160 KDWHLAAQMPGYNFYKVPKYFASDWLNEQLIQQGKDDYRFVYMGPKNSWTSYHADVFGS-----F 219
            .:|   |.:  :..|..|.:                       |...:..:|...:.|:     |
Human   142 TEW---ASL--FRHYSPPPF-----------------------GLLGTAPAYSFGIAGAGSGVPF 178

  Fly   220 SW-----STNIVGLKKWLIMPPGEELKLNDRLGNLPFSIDEKMLDEHNVRYYTINQRANEAVFVP 279
            .|     |..|.|.|:|.:.||.:..:.:.....|.:..|.......:.|......||.|.::.|
Human   179 HWHGPGYSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLRDTYPALPPSARPLECTIRAGEVLYFP 243

  Fly   280 SGWFHQVWNLTDTISVN 296
            ..|:|...||..::.::
Human   244 DRWWHATLNLDTSVFIS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 6/53 (11%)
JmjC 199..299 CDD:202224 23/108 (21%)
JMJD8NP_001005920.3 cupin_like 54..248 CDD:328732 46/254 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.