DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5783 and RIN1

DIOPT Version :9

Sequence 1:	NP_609869.1	Gene:	CG5783 / 35088	FlyBaseID:	FBgn0032670	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_004283.2	Gene:	RIN1 / 9610	HGNCID:	18749	Length:	783	Species:	Homo sapiens

Alignment Length:	90	Identity:	22/90 - (24%)
Similarity:	31/90 - (34%)	Gaps:	13/90 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 DWSSGLKCSSI---PSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGFVLKSL 155
            |.|||....::   |...|..|:.|. :.|..:...:...||..|.....:|   ||.....:..
Human   634 DPSSGCTSKTLAVPPEASIATLNQLC-ATKFRVTQPNTFGLFLYKEQGYHRL---PPGALAHRLP 694

  Fly   156 SVADAPLVNAEWP------NHHEGS 174
            :........||||      ...|||
Human   695 TTGYLVYRRAEWPETQGAVTEEEGS 719

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5783	NP_609869.1	Gly_acyl_tr_N	<91..183	CDD:283638	22/90 (24%)
CG5783	NP_609869.1	FR47	187..272	CDD:117022
RIN1	NP_004283.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..53
		SH2	58..158	CDD:326550
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..282
		Ras and 14-3-3 protein binding region	294..727		22/90 (24%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	295..342
		VPS9	489..607	CDD:128469
		UBQ	627..704	CDD:320785	15/73 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	709..783		3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0.704428	Normalized mean entropy	S1135
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950