DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and TEM1

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_013647.1 Gene:TEM1 / 854938 SGDID:S000004529 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:33/161 - (20%)
Similarity:58/161 - (36%) Gaps:58/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KYCQEYYCLDNF----VEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLV 86
            ||.|..|..:..    |.|||::..:|:..:            :|.|:|              |.
Yeast    39 KYVQNIYDKEYTQTLGVNFLKRKVSIRSTDI------------IFSIMD--------------LG 77

  Fly    87 GKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLV---YRDCTNLFFMKANDA--------- 139
            |:.    ::.:.|..:::.|..|..|..|...:.|:.:   ||....|     ||:         
Yeast    78 GQR----EFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGL-----NDSAIPILVGTK 133

  Fly   140 --LKLKVEPP-----SGFVLKSLSVADAPLV 163
              |.:.::|.     |...:|...|.:|||:
Yeast   134 YDLLIDLDPEYQEQISRTSMKYAQVMNAPLI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 19/92 (21%)
FR47 187..272 CDD:117022
TEM1NP_013647.1 Spg1 21..202 CDD:206701 33/161 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S1135
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.