DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and si:dkey-76k16.5

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001314707.1 Gene:si:dkey-76k16.5 / 566887 ZFINID:ZDB-GENE-090313-330 Length:277 Species:Danio rerio


Alignment Length:282 Identity:54/282 - (19%)
Similarity:96/282 - (34%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IKMY--TLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDL-------------------- 92
            ||:|  .....:.:...|.::||.:..|...:...:...|:|.|.                    
Zfish    24 IKVYGFVFAMNRGKPNTLEILVDSWPAFTTIIVRPDPNNGRAKDFMKKVTLYSTDEEVLRRMLTV 88

  Fly    93 ---LDWSSGLKCSSIPSRHIGALDSL-----VESKKLNLVYRDCTNLFFMKANDALKLKVEPPSG 149
               :|||:.........||:..|..:     |..|.|:||:                |...|..|
Zfish    89 ENAIDWSTYFLIGGCDIRHLPMLKEISAARGVRMKGLSLVH----------------LMTLPEPG 137

  Fly   150 FVLK-----------SLSVADAPLVNAEW-----PNHHEGSLFFVERQIRLCVSVGLYQEDTQEL 198
            .:|:           .|:.:.|.:||..|     ...:...|..:......|::     ::..:.
Zfish   138 HLLQLITSDLESRITVLNESHADVVNKTWKFGGDDKGYRNVLHLISHFPTCCIT-----DENNQP 197

  Fly   199 VAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGF 263
            |:|.:......:|.|.....|:.:|:...:...:|.||..||:.|...:...|:.|.::|:.|||
Zfish   198 VSWVLLYDYCAMGMLYTLPEHRGKGYAKALVTTMAKRLHCQGYPVYCFIEECNQVSCKLFTSLGF 262

  Fly   264 QVIDQCYWLRTEPTGGQFTWPE 285
                      ||....:..|.|
Zfish   263 ----------TEDPSYRAAWYE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 22/135 (16%)
FR47 187..272 CDD:117022 18/84 (21%)
si:dkey-76k16.5NP_001314707.1 Gly_acyl_tr_N 9..187 CDD:283638 31/178 (17%)
NAT_SF 188..277 CDD:302625 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.