DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and Glyatl3

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001138532.1 Gene:Glyatl3 / 435528 MGIID:3647683 Length:290 Species:Mus musculus


Alignment Length:246 Identity:53/246 - (21%)
Similarity:97/246 - (39%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KYCQEYYCLDN-----FVEFLKKQPHMRNI-------KMYTLDA------------KQARDEGLF 66
            |...:.:.|:|     |.|.||....:.||       |...||:            ::|..:.|.
Mouse     5 KCSTKLFILENMLKSHFPESLKVYGAVMNINRGNPFQKEVVLDSWPNFKVIITRREREAETDNLD 69

  Fly    67 VIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNL 131
            ...:.|.:|...:.....|: :..|:::|....:...:.|....|..::.:::.|:|    ..||
Mouse    70 HYTNAYAVFYKDIRAYQQLL-EEHDVINWDQVFQIQGLQSELYAASKAVAKARLLDL----DINL 129

  Fly   132 FFMKANDALKLKVEPPSGFV------LKSLSVADAPLVNAEWP-NHHEGSLFFVERQIRLCVSVG 189
            ...||.....:...|...|:      |..|||:||.|:|..|. ..::..|.::...|....|| 
Mouse   130 ASFKAVHFSPVSSVPDHSFLTGPTPRLTYLSVSDADLLNRTWSRGGNQQCLRYLANLIACFPSV- 193

  Fly   190 LYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQG 240
            ..:::....|:|.|..|...:........|:|:|:..:|...:|.:|..:|
Mouse   194 CVRDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALTLARKLQSRG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 22/98 (22%)
FR47 187..272 CDD:117022 13/54 (24%)
Glyatl3NP_001138532.1 Gly_acyl_tr_N 10..192 CDD:368708 39/186 (21%)
NAT_SF 193..281 CDD:388411 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CTBC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.