DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and GLYATL3

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001010904.1 Gene:GLYATL3 / 389396 HGNCID:21349 Length:288 Species:Homo sapiens


Alignment Length:251 Identity:55/251 - (21%)
Similarity:94/251 - (37%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FVEFLKKQPHMRNI-------KMYTLDA------------KQARDEGLFVIVDRYQLFVGCLNNT 82
            |.|.||....:.||       |...||:            ::|..:.|....:.|.:|...:...
Human    21 FPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAY 85

  Fly    83 NGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPP 147
            ..|: :..|:.:|....:...:.|.......::..||:||:      .|...||.....:...|.
Human    86 RQLL-EECDVFNWDQVFQIQGLQSELYDVSKAVANSKQLNI------KLTSFKAVHFSPVSSLPD 143

  Fly   148 SGFV------LKSLSVADAPLVNAEWP-NHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRL 205
            :.|:      |..||||:|.|:|..|. ..:|..|.::...|....|| ..:::....|:|.|..
Human   144 TSFLKGPSPRLTYLSVANADLLNRTWSRGGNEQCLRYIANLISCFPSV-CVRDEKGNPVSWSITD 207

  Fly   206 QGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKL 261
            |...:........|:|:|:..:|...:|.:|..:|......|...|..|..:...|
Human   208 QFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNTASISLLKSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 23/98 (23%)
FR47 187..272 CDD:117022 17/75 (23%)
GLYATL3NP_001010904.1 Gly_acyl_tr_N 10..190 CDD:283638 38/175 (22%)
NAT_SF 191..279 CDD:302625 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CTBC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.