DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and CG12560

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster


Alignment Length:260 Identity:82/260 - (31%)
Similarity:138/260 - (53%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDR-----YQLFVGCLNNTNGLVGK 88
            |.|.|::||:::::..|.:: :...:|:.....| |.||:..|     ..::...|:.....|.|
  Fly    30 QGYPCINNFIKWVEIDPQLK-VNFLSLNGDWQSD-GTFVLTLRSDTHMNHIYFNTLSENLDRVTK 92

  Fly    89 AL----------DLLDWSSGLKCSSIP-SRHIGALDSLVESKKLNLVYRDCTNLFFMKANDAL-K 141
            ||          |...:|:.||    | ..:||  :....:|||:.|    ..:::..:.:.: .
  Fly    93 ALECLKSIENEYDFFGFSTRLK----PVVEYIG--NKYYANKKLHTV----DTVWYAASKELVDT 147

  Fly   142 LKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRLQ 206
            ..::.|.|..|:.|::.||.::|..||::..||:.||...|:..:::|.| :|..:|||||:||.
  Fly   148 FNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINLGAY-DDKGKLVAWCLRLP 211

  Fly   207 GGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQVIDQCYW 271
            .|.||.|||.::|||.|.||::.:.:|.:::..|..|:|.|...|.||..||.||||:.||..||
  Fly   212 IGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276

  Fly   272  271
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 24/93 (26%)
FR47 187..272 CDD:117022 40/85 (47%)
CG12560NP_609173.2 FR47 193..277 CDD:117022 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449951
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 1 0.900 - - E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6490
98.900

Return to query results.
Submit another query.