DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and CG14615

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:131/318 - (41%) Gaps:66/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTRLEVIGLKDIQEFQQLYK----------------QNWPKYCQEYYCLDNFVEF--LKKQPHMR 48
            |..|..:...::.|...|||                :.|.:...|.....|.:..  |:||    
  Fly     7 GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQ---- 67

  Fly    49 NIKMYTLDAKQARDEGLFV-----IVDRYQLFV----------GCLNNTNGLVGKALDLLDWSSG 98
               .||......|..|.:|     ||.....|.          .||..|        .|::|:.|
  Fly    68 ---FYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQT--------QLIEWTQG 121

  Fly    99 LKCSSIPSRHIGALDSLVESKKLNLVY-RDCTNLFFMKANDALKLKV-EPPSGFVLKSLSVADAP 161
            ...:::.......:..|..|:.:..:. |.|..: .:...||...|| :.||.|.::.|...||.
  Fly   122 ALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGM-VLSHEDAFCAKVPDLPSEFEIRRLRAEDAA 185

  Fly   162 LVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFG- 225
            :|:..|||..||||.:::..:|...|:|:.:.||.||:||..:.....||.|||....:|||.| 
  Fly   186 MVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGG 250

  Fly   226 ---SVVTREIAYRLAVQGHDV--MALVGPSNKPSSEMFSKLGFQ--VIDQCYWLRTEP 276
               :.::||||     :|.::  .|.:..:|..|..:..::|:|  ::::  |::..|
  Fly   251 LLAAAMSREIA-----RGEEITLTAWIVATNWRSEALLKRIGYQKDLVNE--WIKLVP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 25/93 (27%)
FR47 187..272 CDD:117022 27/92 (29%)
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 40/123 (33%)
FR47 211..297 CDD:117022 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.