DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and Rin1

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006531773.1 Gene:Rin1 / 225870 MGIID:2385695 Length:798 Species:Mus musculus


Alignment Length:138 Identity:29/138 - (21%)
Similarity:53/138 - (38%) Gaps:33/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKV---EPPSGFVLKSLSVADAPLV 163
            |..|:|.:...:.|:.::.:.|.         ::||.|..|.|   |||..|:::..:......:
Mouse    72 SQQPARTVSLRERLLITRPVWLQ---------LRANAAAALHVLRTEPPGTFLVRKSNTRQCQAL 127

  Fly   164 NAEWPNHHEGSLF----FVERQ---IRLCVSVGLYQEDTQELVAWC---------IRLQGGYLGA 212
            ....| ...|..|    ::|..   :.|..|..::|:..|.:..:|         :||.    .|
Mouse   128 CVRLP-EASGPSFVSSHYIEESTGGVSLEGSELMFQDLVQLICGYCRTRDILLLPLRLP----RA 187

  Fly   213 LQVKDTHK 220
            :....|||
Mouse   188 IHQAATHK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 18/90 (20%)
FR47 187..272 CDD:117022 10/43 (23%)
Rin1XP_006531773.1 SH2_RIN1 81..177 CDD:198256 20/105 (19%)
VPS9 513..631 CDD:128469
Ubiquitin_like_fold 649..729 CDD:391949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S1135
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.