DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and F43H9.4

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_505068.1 Gene:F43H9.4 / 179182 WormBaseID:WBGene00018400 Length:297 Species:Caenorhabditis elegans


Alignment Length:233 Identity:53/233 - (22%)
Similarity:85/233 - (36%) Gaps:71/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWS 96
            |.|.|....     :.|:.::.|.|.| .|:|....:.|.:     |  .||||...        
 Worm    58 YWLANMTSL-----YERDRQILTHDGK-FREEDFLAVFDEF-----C--KTNGLFAG-------- 101

  Fly    97 SGLKCSSIPSR-----HIGALDSLVESKKLNL-VYRDCTNLFFMKANDALKLK----VEPPSGF- 150
                 |:.||.     :..|::..::...:|. |....|:.|.|..:...|.:    ...|.|: 
 Worm   102 -----SNAPSTVAEKCYTKAIEKYMKKNNINAEVQNKSTHFFAMNESQIFKYRNYGDTTLPDGYS 161

  Fly   151 ---------VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIR----LCVSVGLYQEDTQELVAWC 202
                     |:|.:..:..|  ||:          .||.::|    |||..|      .|||.:.
 Worm   162 IDIPESTNDVMKIVGSSITP--NAK----------LVEEKLRRFPSLCVRKG------DELVGFI 208

  Fly   203 IRLQGGYLGALQVKDTHKRRGFGSVVTREI-AYRLAVQ 239
            .....|.|..|.|.|.|:.:..|..:  || |.::|::
 Worm   209 SSETHGALAHLHVFDGHRGKNLGEKL--EIGAAKMAIE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 19/111 (17%)
FR47 187..272 CDD:117022 15/54 (28%)
F43H9.4NP_505068.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.