DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and Glyatl2

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_599157.2 Gene:Glyatl2 / 171179 RGDID:621231 Length:295 Species:Rattus norvegicus


Alignment Length:328 Identity:65/328 - (19%)
Similarity:112/328 - (34%) Gaps:109/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YCQEYYCLDNFVEFLKKQPHM-RNIKMY--TLDAKQARDEGLFVIVDRYQLF------------- 75
            |.|....|......|:|  |: .::|:|  .....|.....|..:||::..|             
  Rat     3 YIQSSEALQILKNSLRK--HLPESLKVYGTVFHMNQGNPFKLKAVVDKWPDFNTVVIRPQEQDMT 65

  Fly    76 --VGCLNNTNGLVGK----------ALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDC 128
              :...|||..:..|          :.|:::|...|:..|..:.....:::|..:....:.::.|
  Rat    66 DDLDHYNNTYLIYSKDPKHCQEFLGSSDVINWKQHLQIQSSQADLGKVIENLGATNLGKVKHKQC 130

  Fly   129 TNLFFMKANDALKL------------KVEPPSG-----FVLKSLSVADAPLVNAEWP-NHHEGSL 175
              ..:|.::.|.||            ..|.|:.     |....|.|..|.|||:.|. ..:|.|.
  Rat   131 --FLYMVSHTAKKLTPSLVDAKHLVVSSEKPTPFDHQLFKFARLDVKHAALVNSIWYFGGNEKSQ 193

  Fly   176 FFVERQI----RLCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRL 236
            .|:||.|    .:|:   :..|.|.  |:|.:.   .:.|.|::..|..:....:::     |.:
  Rat   194 KFIERCIFTFPSVCI---MGPEGTP--VSWALM---DHTGELRMAGTLPKYRHQNLI-----YHV 245

  Fly   237 AVQGHDVMALVGPSNKPSSEMFSKLGFQV---IDQ------------------CYWLRTEPTGGQ 280
            |.  |.|..|            .||||.:   :|:                  |.|       .|
  Rat   246 AF--HQVHTL------------EKLGFPMYLHVDKVNLTIQRMSAVLGHVPMPCTW-------NQ 289

  Fly   281 FTW 283
            :.|
  Rat   290 WNW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 26/113 (23%)
FR47 187..272 CDD:117022 18/105 (17%)
Glyatl2NP_599157.2 Gly_acyl_tr_N 1..205 CDD:399190 43/205 (21%)
Gly_acyl_tr_C 206..294 CDD:117021 22/121 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.