DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and Glyat

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_666047.1 Gene:Glyat / 107146 MGIID:2147502 Length:296 Species:Mus musculus


Alignment Length:285 Identity:59/285 - (20%)
Similarity:107/285 - (37%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIGLKDIQEFQQLYKQNWPKYCQE--------YYCLD----NFVEFLKKQPHMRNIKMYTLDAKQ 59
            ::.|:..|..|.|.| :..||..|        |:.:.    |....:.|.|....:.:...:.:.
Mouse     2 IVPLQGAQMLQMLEK-SLRKYLPESLKVYGTVYHMIHGNPFNLKALVDKWPDFNTVVVRPQEQEM 65

  Fly    60 ARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLV 124
            ..|  |...::.||::.....|....: ::.::::|...|:..|..|.....:.:|...:...:.
Mouse    66 TDD--LDFYINTYQVYSKDPQNCQEFL-ESSEVINWKQHLQIQSSQSHLNKTIQNLASIQSFQIK 127

  Fly   125 YRDCTNLFFMKANDALKL--------KVEPPSG---------FVLKSLSVADAPLVNAEWP-NHH 171
            :.:  |:.::.:....||        .:...||         |.|.||.|..|.|||..|. ..:
Mouse   128 HSE--NILYVSSETIKKLFPSLLDTKNLSTGSGKPKAIDQDKFKLSSLDVVHAALVNKFWLFGGN 190

  Fly   172 EGSLFFVERQIR----LCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREI 232
            |.|..|:||.|:    .||   |..|.|.  .:|.:..|.|.:........::.:|..|.|....
Mouse   191 ERSQRFIERCIKNFPSSCV---LGPEGTP--ASWTLMDQTGEMRMGGTMPEYRLQGLVSFVVHSQ 250

  Fly   233 AYRLAVQGHDVMALVGPSNKPSSEM 257
            ...:..:|:.|.:....||....:|
Mouse   251 DQIMTKRGYPVYSHTEKSNIAMQKM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 25/109 (23%)
FR47 187..272 CDD:117022 14/71 (20%)
GlyatNP_666047.1 Gly_acyl_tr_N 11..206 CDD:283638 41/200 (21%)
Gly_acyl_tr_C 207..295 CDD:117021 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9338
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.