DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and GLYAT

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_964011.2 Gene:GLYAT / 10249 HGNCID:13734 Length:296 Species:Homo sapiens


Alignment Length:258 Identity:62/258 - (24%)
Similarity:98/258 - (37%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGK 88
            ||.:.....|       .::|....::..||               :.||::.....|....:|.
Human    50 WPDFNTVVVC-------PQEQDMTDDLDHYT---------------NTYQIYSKDPQNCQEFLGS 92

  Fly    89 ALDLLDWSSGLKC-SSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDA-------LKLKVE 145
            . :|::|...|:. ||.||.: .|:.:|...|...:  :....:.:|.|..|       ||.|:.
Human    93 P-ELINWKQHLQIQSSQPSLN-EAIQNLAAIKSFKV--KQTQRILYMAAETAKELTPFLLKSKIL 153

  Fly   146 PPSG----------FVLKSLSVADAPLVNAEWPNH---HEGSLFFVERQIR---LCVSVGLYQED 194
            .|:|          |.|.|:.|..|.|||..|  |   :|.|..|:||.|:   .|..:|  .|.
Human   154 SPNGGKPKAINQEMFKLSSMDVTHAHLVNKFW--HFGGNERSQRFIERCIQTFPTCCLLG--PEG 214

  Fly   195 TQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEM 257
            |.  |.|.:..|.|.:........::..|..:.|....|.:|...|..|.:.|..||:...:|
Human   215 TP--VCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 33/112 (29%)
FR47 187..272 CDD:117022 17/71 (24%)
GLYATNP_964011.2 Gly_acyl_tr_N 11..206 CDD:310541 44/183 (24%)
Gly_acyl_tr_C 207..295 CDD:117021 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9338
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.