DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5783 and GLYATL1B

DIOPT Version :9

Sequence 1:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001342495.1 Gene:GLYATL1B / 100287520 HGNCID:37865 Length:302 Species:Homo sapiens


Alignment Length:281 Identity:56/281 - (19%)
Similarity:101/281 - (35%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NWPKYCQEYYCLDNFVEFLKKQPHMRNI-KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLV 86
            :||:| |.........|.........|: ::::.|.:::::                       |
Human    48 SWPEY-QMVIIRPQKQEMTDDMDSYTNVYRVFSKDPQKSQE-----------------------V 88

  Fly    87 GKALDLLDWSSGLKCSSIPSRHIGALDSLVE---------------SKKLNLVYRDCTNLFFMKA 136
            .|..::::|...|:..       |..:||.|               |:.|..|..|...|:   |
Human    89 LKNSEIINWKQKLQIQ-------GFQESLGEGIRAAAFSNSVKVEHSRALLFVTEDILKLY---A 143

  Fly   137 NDALK-------------LKVEPPSGFVLKSLSVADAPLVNAEWP-NHHEGSLFFVERQI-RLCV 186
            .:..|             |:.|.|: |....|:|:.:.|||..|. ..::.||.:::|.: .|..
Human   144 TNKSKLGSWAETGHPDDELESETPN-FKYAQLNVSYSGLVNDNWKLGMNKRSLRYIKRCLGALPA 207

  Fly   187 SVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGS-VVTREIAYRLAVQGHDVMALVGPS 250
            :..|..|...  |:|........:|.....:.::|||.|: ::.|.:.| |..:.......|...
Human   208 ACMLGPEGVP--VSWVTMDPSCEIGMGYSVEKYRRRGNGTRLIMRCMKY-LCQKNIPFYGSVLEE 269

  Fly   251 NKPSSEMFSKLGFQVIDQCYW 271
            |:......|.||| :...|.|
Human   270 NQGVIRKTSALGF-LEASCQW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 26/121 (21%)
FR47 187..272 CDD:117022 20/86 (23%)
GLYATL1BNP_001342495.1 Gly_acyl_tr_N 10..207 CDD:310541 36/193 (19%)
NAT_SF 208..296 CDD:327402 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.