DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and si:dkey-76k16.5

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001314707.1 Gene:si:dkey-76k16.5 / 566887 ZFINID:ZDB-GENE-090313-330 Length:277 Species:Danio rerio


Alignment Length:288 Identity:56/288 - (19%)
Similarity:98/288 - (34%) Gaps:105/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DQLKDVQ----------------VYAL----PN-LELGIFVIVDHYQIFVGFL-EAEQSESLFKE 86
            |:||:.:                |:|:    || ||    ::||.:..|...: ..:.:....|:
Zfish     7 DELKEAETSLYAHLPKAIKVYGFVFAMNRGKPNTLE----ILVDSWPAFTTIIVRPDPNNGRAKD 67

  Fly    87 SLLKFKLYGGEQFASMPKRYFNVAN----------------------DIIQAKNLKLDLDCVTLS 129
            .:.|..||..::  .:.:|...|.|                      :|..|:.:::.    .||
Zfish    68 FMKKVTLYSTDE--EVLRRMLTVENAIDWSTYFLIGGCDIRHLPMLKEISAARGVRMK----GLS 126

  Fly   130 LVLSKEEALLFQVEPPAGFSLKPVDIDD---------AQVINDQWEWSEPDS-----LSVVRR-- 178
            ||     .|:...||.....|...|::.         |.|:|..|::...|.     |.::..  
Zfish   127 LV-----HLMTLPEPGHLLQLITSDLESRITVLNESHADVVNKTWKFGGDDKGYRNVLHLISHFP 186

  Fly   179 -------------QILAPD----GLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVP 226
                         .:|..|    |:|..|   ..::.:|:.:.:|...|::....|......:..
Zfish   187 TCCITDENNQPVSWVLLYDYCAMGMLYTL---PEHRGKGYAKALVTTMAKRLHCQGYPVYCFIEE 248

  Fly   227 ENKASLGLFTKLGFKINDQCHWLMTEPP 254
            .|:.|..|||.|||          ||.|
Zfish   249 CNQVSCKLFTSLGF----------TEDP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 16/69 (23%)
si:dkey-76k16.5NP_001314707.1 Gly_acyl_tr_N 9..187 CDD:283638 35/192 (18%)
NAT_SF 188..277 CDD:302625 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.