DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and CG17681

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:130/274 - (47%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQQLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQVYALPN--LELGIFVIVDHYQIF 71
            |..|.||:.::.::||..|..|:.||.:|....::..||.:..|.|.|  ...|:|::|..||:|
  Fly    13 VANLKDLQILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWRSDGLFILVHRYQLF 77

  Fly    72 VGFLEAEQSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEE 136
            ...|..::::  .:.:|.:.....|.:.:::.:.:..:...:.....|.:|.:..|:..:|::||
  Fly    78 FSNLSKQKTD--LEVALKQLDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIMYILNREE 140

  Fly   137 ALLFQVEPPAGFSLKPVDIDDAQVINDQWEWSEPDSLSVVRRQIL-------------------- 181
            |...|::.|.|:.|..|.::.|.:|||.|....|.||.:::..|.                    
  Fly   141 AERLQIQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEKELGSLCAWCL 205

  Fly   182 -APDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRDTITEVVP-ENKASLGLFTKLGFKI-- 242
             ...|.|..|:|..|::|||.|.::....::..|...:..||.:|. .|.|:..:|.||.|::  
  Fly   206 RLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITALVNINNSAACRVFEKLNFRLIQ 270

  Fly   243 NDQCHWLMTEPPKG 256
            ::..:|.|.:|..|
  Fly   271 DEHYYWSMIKPAAG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 19/68 (28%)
CG17681NP_724098.2 FR47 189..277 CDD:117022 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449946
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 1 0.900 - - E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.