DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and Glyat

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:207 Identity:40/207 - (19%)
Similarity:76/207 - (36%) Gaps:75/207 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQVY---ALPNLELGIFVIVDHYQIFVGFLEAE 78
            :::::: |:.|:|:......:. :|:..|::..|.:   |:.||            ..:..|:.:
  Rat    77 QIYSKD-PENCQEFLGSSEVIN-WKQHLQIQSSQSHLNKAIQNL------------ASIHSLQVK 127

  Fly    79 QSESLF---KESLLKFKLYGGEQFASMPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEALLF 140
            .||::.   .|::.|.       |.|:                    ||...||....|.:|:..
  Rat   128 HSENILYVVSETVRKL-------FPSL--------------------LDTKNLSPGSGKPKAINQ 165

  Fly   141 QVEPPAGFSLKPVDIDDAQVINDQW-----EWSE----------PDSLSVVRRQILAPDGLLA-- 188
            ::     |.|..:|:..|.::|..|     |.|:          |.|.      :|.|:|..|  
  Rat   166 EM-----FKLSSLDVTHAALVNKFWLFGGNERSQRFIERCIKNFPSSC------VLGPEGTPASW 219

  Fly   189 VLQVKTTYKRRG 200
            .|..:|...|.|
  Rat   220 TLMDQTGEMRMG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 7/20 (35%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 30/174 (17%)
Gly_acyl_tr_C 207..295 CDD:117021 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.