DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and GLYATL2

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_659453.3 Gene:GLYATL2 / 219970 HGNCID:24178 Length:294 Species:Homo sapiens


Alignment Length:281 Identity:54/281 - (19%)
Similarity:97/281 - (34%) Gaps:91/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFTREWPKY--------------CKEYYCLDTFLELYKKDDQLKDVQVYALPNLELGIFVIVDHY 68
            |....||.|              .:::| .:|:....|..|:|::|..|:         .::...
Human    44 VLVDAWPDYQIVITRPQKQEMKDDQDHY-TNTYHIFTKAPDKLEEVLSYS---------NVISWE 98

  Fly    69 QIFVGFLEAEQSESLFKESLLKFKLYGGEQ---------FASMPKRYFNVANDIIQAKNLKLDLD 124
            |.    |:.:..:....|::.|.......|         ...:||::...:||.::         
Human    99 QT----LQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKME--------- 150

  Fly   125 CVTLSLVLSKEEALLFQVE---PPAGFSLKPVDIDDAQVINDQWEWSEPD-SLSVVRR------- 178
                          ||:|:   ....||...:|...|.::|:.|.:.:.: ||..:.|       
Human   151 --------------LFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDFLG 201

  Fly   179 -QILAPDGLLA--VLQVKTTYKRRGFGQLIVKEFARQ----------EALLGRDTIT---EVVPE 227
             .:|.|:|.|.  ::..::...|.|:   .|.::..|          |..|.:..|.   .|...
Human   202 FGVLGPEGQLVSWIVMEQSCELRMGY---TVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADN 263

  Fly   228 NKASLGLFTKLGFKINDQCHW 248
            |:.||.....||||| ..|.|
Human   264 NEKSLQALNNLGFKI-CPCGW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 21/81 (26%)
GLYATL2NP_659453.3 Gly_acyl_tr_N 10..199 CDD:310541 32/191 (17%)
Gly_acyl_tr_C 202..290 CDD:117021 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.