DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15155 and glyatl2

DIOPT Version :9

Sequence 1:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:glyatl2 / 100490041 XenbaseID:XB-GENE-22068497 Length:282 Species:Xenopus tropicalis


Alignment Length:282 Identity:49/282 - (17%)
Similarity:80/282 - (28%) Gaps:122/282 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFTREWPKY-------------CKEYYCLDTFLELYKKDD----------------QLKDVQVY- 52
            |....||.|             |..|....:|   :.:|:                :::.:|.| 
 Frog    44 VLVDSWPNYGAVMTRPLTAPPICDPYTNSYSF---FIRDENRIHAVLEHINWNQAFEIQSMQNYF 105

  Fly    53 --------ALPNLELGIFVIVDHYQIFVGFLEAEQSESLFKESLLKFKLYGGEQFASMPKRYFNV 109
                    |..|::..|.::..:||       ..|.|:            ||||.    :|:   
 Frog   106 MNKIRHEAAQRNVDTEISLLRTYYQ-------GTQKET------------GGEQV----QRH--- 144

  Fly   110 ANDIIQAKNLKLDLDCVTLSLVLSKEEALLFQVEPPAGFSLKPVDIDDAQVINDQWEW------- 167
                  .|||:.   |                       ||.|..:   .:::|.|.:       
 Frog   145 ------QKNLEF---C-----------------------SLSPAYV---SLVDDSWTFGRCSASQ 174

  Fly   168 --------SEP-----DSLSVVRRQILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQEALLGRD 219
                    |.|     ||...|...:....|.:.:|......:|:|.|..:....:.......|.
 Frog   175 EYVSLCIKSHPSCCVLDSGIPVSWVLCDHYGAMRMLYTVPQERRKGLGSKVCSVLSEIMTKQNRP 239

  Fly   220 TITEVVPENKASLGLFTKLGFK 241
            ....|..||..|..:|..||.:
 Frog   240 IYCHVEEENIPSQLMFKDLGLQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 13/59 (22%)
glyatl2XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:368708 32/205 (16%)
NAT_SF 187..259 CDD:388411 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.