DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and GLYATL1

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_542392.2 Gene:GLYATL1 / 92292 HGNCID:30519 Length:333 Species:Homo sapiens


Alignment Length:280 Identity:47/280 - (16%)
Similarity:94/280 - (33%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NPTLKHLNFYTLDNDW--------------RSDGLFILVHRYQLFFSNLSKQKTDLEVALKQ--- 94
            ||    .|...|.:.|              .:|.:....:.|::|    ||:....|..||.   
Human    69 NP----FNMEVLVDSWPEYQMVIIRPQKQEMTDDMDSYTNVYRMF----SKEPQKSEEVLKNCEI 125

  Fly    95 LDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIMYI-----LNREEAERL----QIQCPD 150
            ::|.:..::..:.|...:..:.......:.::.....::..     ||.....:|    :...||
Human   126 VNWKQRLQIQGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPD 190

  Fly   151 GYF-----------LDKVRLEHADLINDLWS-ARHPGSLKLIQMLITYNTNVGLYEKELGSLC-- 201
            ..|           ||   :.::.|:||.|. .::..||..|:..|          ::|.:.|  
Human   191 DEFESETPNFKYAQLD---VSYSGLVNDNWKRGKNERSLHYIKRCI----------EDLPAACML 242

  Fly   202 -------AWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITALVNI--NNSAA 257
                   :|.....|..:|....:..::|.|....|.....|.:.   |::|...:::  .|..:
Human   243 GPEGVPVSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYMKYLR---QKNIPFYISVLEENEDS 304

  Fly   258 CRVFEKLNFRLIQDEHYYWS 277
            .|...:..|.....|.:.|:
Human   305 RRFVGQFGFFEASCEWHQWT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 15/98 (15%)
GLYATL1NP_542392.2 Gly_acyl_tr_N 51..238 CDD:283638 32/189 (17%)
Gly_acyl_tr_C 239..327 CDD:117021 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.