DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and Glyatl3

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001138534.1 Gene:Glyatl3 / 688536 RGDID:1587643 Length:290 Species:Rattus norvegicus


Alignment Length:244 Identity:52/244 - (21%)
Similarity:98/244 - (40%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SDGLFILVHRYQLFFSNLSKQKTDLEVALKQLDWSRGFKVSAIHEIHHKIYKQLA----LDLGLN 124
            :|.|....:.|.:|:.::...:..|| ....::|.:.|::..:....:...|.:|    |||.:.
  Rat    65 TDNLDHYTNAYAVFYKDVRAYQQLLE-EHDVINWDQIFQIQGLQSELYTASKAIASAKLLDLEIK 128

  Fly   125 MDREMNTIMYILNREEAERLQIQCPDGYFL--DKVRLEH-----ADLINDLWS-ARHPGSLKLIQ 181
            : .....:.:.....|        ||..||  ...||.:     |||:|..|| ..:...|:.:.
  Rat   129 L-ASFKAVHFSPVSSE--------PDHSFLTGSTPRLTYLSVTDADLLNRTWSRGGNQQCLRYLA 184

  Fly   182 MLITYNTNVGLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIAT------ 240
            .||....:|.:.: |.|:..:|.:..|...:.....||.|:|:|...:||..:::.:.:      
  Rat   185 KLIACFPSVCVRD-EKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALTLARKLQSRGFPSQ 248

  Fly   241 -DLQQDITALVNINNSA-----ACRVFEKLNFRLIQDEHYYWSMIKPAA 283
             ::..|..|.:|:..|.     .|| |.:|             ::.|||
  Rat   249 GNVLDDNMASINLLKSVHAEFLPCR-FHRL-------------ILTPAA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 20/99 (20%)
Glyatl3NP_001138534.1 Gly_acyl_tr_N 1..192 CDD:399190 29/136 (21%)
NAT_SF 193..281 CDD:418431 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CTBC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.