DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and Glyat

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:137/294 - (46%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DLQILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWRSDGLFILVH----RYQLFF 78
            :|:.||..| .:|..|:..::.:|.::..: |.:.:..||.|.|||:.|.:||:|    :..::.
  Fly    13 ELRDLYAND-RTNLTGFDLIEYFLNYIPLS-TTESIKIYTTDTDWRTHGSYILIHYLENKAYIYM 75

  Fly    79 SNLSKQKTDLEVALKQLDWSRGFKVSAIHEI--HHKIYKQLA----LDLG---LNMDREMNTIMY 134
            :.:.....||...|..|      |:...|.|  :.:.:|.|.    |:||   :|::.: ..|:|
  Fly    76 NTIKGTPEDLGKLLNSL------KLKVFHLICGYEERFKPLVEAYWLNLGQDLINLEHQ-GAIVY 133

  Fly   135 ILNREE----AERLQIQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEK 195
            .|...|    ...|...|...|    :...||:|::..|:.|...|:.:|:..:..|..||:::.
  Fly   134 HLPSTEIPSWKPSLSTSCKVAY----ITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVFDN 194

  Fly   196 ELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQ---QDITALVNINNSAA 257
            : |...|||||...|.|..|.||.:|:|.|||.:..    :.:|.:::   .::.|.|...|..:
  Fly   195 Q-GEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAV----RFMANEIKLKGSEVLATVVPENEGS 254

  Fly   258 CRVFEKLNFRLIQDEHYYWSMIKPAAGGQISWPC 291
            .::||||.|..|  ...||::|          ||
  Fly   255 QKMFEKLGFNNI--NKLYWAVI----------PC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 29/90 (32%)
GlyatNP_001033883.2 RimI <155..264 CDD:223532 35/117 (30%)
NAT_SF 189..272 CDD:302625 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449950
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.