DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and CG5783

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster


Alignment Length:287 Identity:106/287 - (36%)
Similarity:161/287 - (56%) Gaps:9/287 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRITDVANLKDL---QILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLD-NDWRSDGLF 68
            ||: :|..|||:   |.||.::||..|..|:.|||::.::.:.|.::::..|||| ...|.:|||
  Fly     3 TRL-EVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNIKMYTLDAKQARDEGLF 66

  Fly    69 ILVHRYQLFFSNLSKQKTDLEVALKQLDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIM 133
            ::|.|||||...|:.....:..||..||||.|.|.|:|...|......|.....||:.....|.:
  Fly    67 VIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNL 131

  Fly   134 YILNREEAERLQIQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEKELG 198
            :.:...:|.:|:::.|.|:.|..:.:..|.|:|..|...|.|||..::..|....:||||:::..
  Fly   132 FFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQ 196

  Fly   199 SLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITALVNINNSAACRVFEK 263
            .|.|||:|||.|:||||:|..||:|||.|.||...|:..:|.. ..|:.|||..:|..:..:|.|
  Fly   197 ELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQ-GHDVMALVGPSNKPSSEMFSK 260

  Fly   264 LNFRLIQDEHYYWSMIKPAAGGQISWP 290
            |.|::|  :..||...:| .|||.:||
  Fly   261 LGFQVI--DQCYWLRTEP-TGGQFTWP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 38/87 (44%)
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 26/91 (29%)
FR47 187..272 CDD:117022 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449945
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 1 0.900 - - E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26640
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.