DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and CG15628

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster


Alignment Length:260 Identity:54/260 - (20%)
Similarity:119/260 - (45%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DLQILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTL---DNDWRSDGLFI-LVHRYQLFF 78
            |.:....||||                 ..|.:.|....||   :|.:::.|:|. ..|     .
  Fly    49 DFKFYVAKDWP-----------------DKPIILHFPGCTLAPHNNIYQTLGIFCPSAH-----I 91

  Fly    79 SNLSKQKTDLEVALKQLDWSRGFKVSAIH-EIHHKI---YKQLALDLGLNMDREMNTIMYILNRE 139
            .::...:|: :|.   :||.:...::..| .|.:::   |.:..:     |:| ::..:|:.|:.
  Fly    92 EHVDMLRTE-DVL---IDWQKPMYLNFTHIAIMNRLDDFYSKFGV-----MER-LSGDIYVCNKL 146

  Fly   140 EAERLQIQ-CPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEKELGSLCAW 203
            .|: |::: .|:...:..:.|::...|:||:.|.....::|..:|:.....:|::.||.|.|.||
  Fly   147 NAD-LELEPLPEDAEMRLLNLDNVQGIHDLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAW 210

  Fly   204 CLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITALVNI--NNSAACRVFEKLNF 266
            .:....|.:.:::..|..:|.|.|:.:|.::::.:   :::..|..|.|  .|.|:..::.||.:
  Fly   211 MVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLV---IERGYTPFVVIRPGNDASRSLYTKLGY 272

  Fly   267  266
              Fly   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 20/80 (25%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.